DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and ife-2

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_508094.1 Gene:ife-2 / 180393 WormBaseID:WBGene00002060 Length:228 Species:Caenorhabditis elegans


Alignment Length:217 Identity:79/217 - (36%)
Similarity:122/217 - (56%) Gaps:29/217 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLY 120
            ||.....|.:.|          :||  |...||.|||.::|:||||:....:.:|.:|.:||:|:
 Worm     4 EPVAAPGTISHP----------VYK--LKRNWTWWYLNDERNKSWEERLKNVKTFSSVGEFWALH 56

  Fly   121 NHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTD-LDNLWLDVLLCLIGEA 184
            :.|||||.:...|||::|:..|.||||...|:.||||:||:.|....: :|.:|.::|:.:|||.
 Worm    57 DSIKPPSGLNPPSDYNVFRDGIEPMWEVPQNQNGGRWLITIEKGRTPEIMDTIWTEILMAMIGEQ 121

  Fly   185 F-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNS-----------L 237
            | |..:.:||.|.|:|||.:|||:||.:..::.|.|.||..|:..|    ||:           |
 Worm   122 FSDDIESLCGIVCNVRGKGSKISVWTTNSADDGANLRIGGVLKQVL----NNASMIHQRPLYDVL 182

  Fly   238 QYQLHKDTMVKQGSNVKSIYTL 259
            :|:.|:....|..|.||:.:.:
 Worm   183 RYEDHESCQKKTSSGVKAKHAI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 67/169 (40%)
ife-2NP_508094.1 IF4E 23..168 CDD:279921 63/148 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.