DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and Eif4e

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_446426.1 Gene:Eif4e / 117045 RGDID:69647 Length:217 Species:Rattus norvegicus


Alignment Length:233 Identity:108/233 - (46%)
Similarity:139/233 - (59%) Gaps:24/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PE-PPTSAAAPAEAKDVKPKEDPQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLE 93
            || .||:...|||.:..   |..||...|                  ||..||||.|.|.||:.:
  Rat     6 PETTPTTNPPPAEEEKT---ESNQEVANP------------------EHYIKHPLQNRWALWFFK 49

  Fly    94 NDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWV 158
            ||:||:|:.....|:.||||||||:|||||:..|.:..|.||||||..|.|||||..||:||||:
  Rat    50 NDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWL 114

  Fly   159 ITLNKSS-KTDLDNLWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEI 221
            |||||.. ::|||..||:.|||||||:| |:||.:||||:|:|.|.:||:|||.:..|.:|...|
  Rat   115 ITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHI 179

  Fly   222 GHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL 259
            |...::.|.|.....:.||.|.||..|.||..|:.:.:
  Rat   180 GRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 217

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 84/158 (53%)
Eif4eNP_446426.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 8/23 (35%)
EIF4EBP1/2/3 binding. /evidence=ECO:0000250|UniProtKB:P06730 37..40 2/2 (100%)
IF4E 38..197 CDD:396291 84/158 (53%)