DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p1 and CYP702A1

DIOPT Version :9

Sequence 1:NP_524828.1 Gene:Cyp4p1 / 45524 FlyBaseID:FBgn0015037 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:500 Identity:97/500 - (19%)
Similarity:186/500 - (37%) Gaps:110/500 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLDLYGRD 65
            ::.:.:.|.:..|.:|::::                |:..|.|.:.|.:.|..|.|.|.:.....
plant     7 LLTVMVSLIVVKLFHWIYQS----------------KNPKPNEKLPPGSMGFPIIGETFEFMKPH 55

  Fly    66 HAGVF-NYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENV----LNHPNLITKGLVYNF----- 120
            .|..| .:.:||....|..:...:||..:  ||..|...|:    .||...:||.:...|     
plant    56 DAFQFPTFIKERIIRYGPIFRTSLFGAKV--IISTDIELNMEIAKTNHAPGLTKSIAQLFGENNL 118

  Fly   121 ------LHPFLRT---GLLTSTGKKWHARRKMLTPTFHFNILNQFQEIFKTESQKFLLQFEGQDE 176
                  .|..:|.   .||.|.|.|             .:::.....:.:|..:      ||...
plant   119 FFQSKESHKHVRNLTFQLLGSQGLK-------------LSVMQDIDLLTRTHME------EGARR 164

  Fly   177 VTITLHDVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFSQIEECFIRRLSNPLLW-------- 233
            ..:.:.::..:..:..:.:...|....|.|::       .:....||      |..|        
plant   165 GCLDVKEISSKILIECLAKKVTGDMEPEAAKE-------LALCWRCF------PSGWFRFPLNLP 216

  Fly   234 GDKLFEMFAAKDFASALDVVHRFSSEIIAKRR-DLLKDELDKSSSTADDDGFVSKKRFAMLDTLI 297
            |..:::|..|:                  ||. .|||:.:.|..::.::.|...|..|...:|: 
plant   217 GTGVYKMMKAR------------------KRMLHLLKETILKKRASGEELGEFFKIIFEGAETM- 262

  Fly   298 YAEKDGLIDHIGICEEVDTLMFEGYDTTSIGLIFGLMNMSLNPDKQELCYQE---IQEHIDDDLS 359
              ..|..|::|      .||.....:||...|...:..:|.||...:..::|   |.....:..:
plant   263 --SVDNAIEYI------YTLFLLANETTPRILAATIKLISDNPKVMKELHREHEGIVRGKTEKET 319

  Fly   360 NLDVGQLNKLKYLEYFMKETTRLFPSVPIMGREAVQETELANGLILPKGAQITIHVFDIHRNAKY 424
            ::...:...:.:.:..:.|:.|:..:.|.:.|....|.::.:..| |.| .|.:...:.|.|.|.
plant   320 SITWEEYKSMTFTQMVINESLRITSTAPTVFRIFDHEFQVGSYKI-PAG-WIFMGYPNNHFNPKT 382

  Fly   425 WDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIGKKYAMQEM 469
            :|.|..|.|.|:..:::....:..|:||.||.|.|:|.::|..:|
plant   383 YDDPLVFNPWRWEGKDLGAIVSRTYIPFGAGSRQCVGAEFAKLQM 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p1NP_524828.1 p450 54..509 CDD:278495 88/446 (20%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 96/498 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.