DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_524828.1 Gene:Cyp4p1 / 45524 FlyBaseID:FBgn0015037 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:153 Identity:33/153 - (21%)
Similarity:57/153 - (37%) Gaps:42/153 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IIDADSAENVLNHPNLITKGLVYNFLHPFLRTGLLTSTGKKWHARRKMLTPTFHFNILNQFQEIF 160
            ::|.::...:::...|..|..:.:..|.|| :|||...|.||...|.:|.|.|..:.|......|
plant   110 VMDPETLREIMSKHELFPKPKIGSHNHVFL-SGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAF 173

  Fly   161 KTESQKFLLQFEGQDEVTITL--------HDVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFS 217
            .:..::.|.::|.......|:        ||:    |.|.:..          |..||.|::   
plant   174 NSSCKEMLEEWERLASAKGTMELDSWTHCHDL----TRNMLAR----------ASFGDSYKD--- 221

  Fly   218 QIEECFIRRLSNPLLWGDKLFEM 240
                            |.|:||:
plant   222 ----------------GIKIFEI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p1NP_524828.1 p450 54..509 CDD:278495 33/153 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.