DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p1 and AT5G51900

DIOPT Version :9

Sequence 1:NP_524828.1 Gene:Cyp4p1 / 45524 FlyBaseID:FBgn0015037 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:278 Identity:63/278 - (22%)
Similarity:102/278 - (36%) Gaps:70/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 KDFASALDVVHRFSSEIIAKRRDLLKDELDKSSSTADDDGFVSKKRFAM------LDTLIYAEKD 302
            |....|..:..|...:.|:.||:.:     |.|...::|.|:......:      |||..|...|
plant    23 KKMIEAGAIFDRVCGKYISARREEV-----KRSQVNNNDHFIRDSHANLLTSHIKLDTTQYQLLD 82

  Fly   303 GLIDHIGICEEVDTLMFEGYDTTSIGLIFGLMNMSLNPDKQELCYQEIQEHIDDDLSNLDVGQLN 367
            .:.|.. :.:.|..|:..|.|||:..|.:....:|.||    |...:|::.||.:|.....||..
plant    83 PINDKF-LRDNVFALLLAGRDTTASALTWFFWFLSENP----LVVTKIRQEIDMNLPRSCSGQER 142

  Fly   368 -KLKYLEYFMKETTRLFPSVPIMGREA--VQETELANGLILPKGAQITIHVFDIHRNAKYWDSPE 429
             ....:||..|:      ....|||..  :|..|:                              
plant   143 PSCDPMEYLNKD------DESCMGRRCIRIQAREM------------------------------ 171

  Fly   430 EFRPERFLPENVQDRHTYAYVPFSAGQRNCIGKKYAMQEMKTLMVVLLKQFKVLKAIDPQKIVFH 494
            :||..|              |......|.|.||:.||.:||.:.|.:|:.:.: |..:.||....
plant   172 DFRDRR--------------VSIQCRSRICHGKQRAMVQMKIVAVEILQNYDI-KVANGQKFEPD 221

  Fly   495 TGITLRTQDKIRVKLVRR 512
            |.:.|:.:...:||:.:|
plant   222 TSLILKMKHGFKVKINKR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p1NP_524828.1 p450 54..509 CDD:278495 61/273 (22%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 62/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.