DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p1 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_524828.1 Gene:Cyp4p1 / 45524 FlyBaseID:FBgn0015037 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:437 Identity:134/437 - (30%)
Similarity:218/437 - (49%) Gaps:63/437 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VLNHPNLITKGL------------VYNFLHPFLRTGLLTSTGKKWHARRKMLTPTFHFNILNQFQ 157
            ||.||:.|...|            .|:||.|:|..|||.|.|.||...|::|||.|||:||..:.
Mouse   108 VLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGDGLLISKGNKWSRHRRLLTPAFHFDILKPYM 172

  Fly   158 EIF------------KTESQKFLLQFEGQDEVTITLHDVIPR--FTLNSICETAMGVKLDEMAEK 208
            :||            :..::..:..|:..:.:::...|.:.:  |:.||.|:           |:
Mouse   173 KIFNQCTNIMHAKWRRHLAEGSVTSFDMFEHISLMTLDSLQKCVFSYNSDCQ-----------ER 226

  Fly   209 GDRYRENFSQIEECFIRRLSNPLLWGDKLFEMFA-AKDFASALDVVHRFSSEIIAKRRDLLKDE- 271
            ...|..:..::....:||......:.|.::.:.| .:.|..|.|.||.|::|:|.:||..|:.: 
Mouse   227 MSDYISSIIELSALVVRRQYRLHHYLDFMYYLTADGRRFRQACDTVHNFTTEVIQERRQALRQQG 291

  Fly   272 -----LDKSSSTADDDGFVSKKRFAMLDTLIYA-EKDG--LIDHIGICEEVDTLMFEGYDTTSIG 328
                 ..|...|.|           .:|.|:.| :::|  |.|. .|..|.||.||||:||||.|
Mouse   292 AEAWLKAKQGKTLD-----------FIDVLLLAKDEEGKELSDE-DIRAEADTFMFEGHDTTSSG 344

  Fly   329 LIFGLMNMSLNPDKQELCYQEIQEHIDD-DLSNLDVGQLNKLKYLEYFMKETTRLFPSVPIMGRE 392
            |.:.|.|::..|:.||.|.:||||.:.. :|..||...|.:|.:....:||:.|.||.|.::.|.
Mouse   345 LSWALFNLAKYPEYQEKCREEIQEVMKGRELEELDWDDLTQLPFTTMCIKESLRQFPPVTLISRR 409

  Fly   393 AVQETELANGLILPKGAQITIHVFDIHRNAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQR 457
            ..::.:|.:|.::|||....:.::..|.|...|...:.:.|.||.|:..|.|...|:||||||.|
Mouse   410 CTEDIKLPDGRVIPKGIICLVSIYGTHHNPIVWPDSKVYNPYRFDPDTPQQRSPLAFVPFSAGPR 474

  Fly   458 NCIGKKYAMQEMKTLMVVLLKQFKVLKAID-PQKIVFHTGITLRTQD 503
            ||||:.:||.||:.::.:.|.:|::  ::| ..|:.....:.|||::
Mouse   475 NCIGQSFAMAEMRVVVALTLLRFRL--SVDRTHKVRRKPELILRTEN 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p1NP_524828.1 p450 54..509 CDD:278495 134/437 (31%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 131/431 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.