DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p1 and CYP4X1

DIOPT Version :9

Sequence 1:NP_524828.1 Gene:Cyp4p1 / 45524 FlyBaseID:FBgn0015037 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:427 Identity:121/427 - (28%)
Similarity:214/427 - (50%) Gaps:19/427 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLRTGLLTSTGKKWHARRKMLTPTFHFNILNQ 155
            :|.:.|.|.|.|:.:|:..:..::.| ..|..|.|..||....|.||...|::|||.||||||..
Human    88 QAFFCIYDPDYAKTLLSRTDPKSQYL-QKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKA 151

  Fly   156 FQEIFKTESQKFLLQFE---GQDEVTITLHDVIPRFTLNSICETAMGVKLD-EMAEKGDRYRENF 216
            :.|:.....:..|.::|   ...:.::.:::.|...:|:.|.:.|...:.: :.....|.|.:..
Human   152 YIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAI 216

  Fly   217 SQIEECFIRRLSNPLLWGDKLFEMF-AAKDFASALDVVHRFSSEIIAKRRDLLKDELDKSSSTAD 280
            .::.:....||.:.|...|.:|::. ....|.....|:::::..||.:|:..|:       :...
Human   217 FELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQ-------AGVK 274

  Fly   281 DDGFVSKKRFAMLDTLIYA--EKDGLIDHIGICEEVDTLMFEGYDTTSIGLIFGLMNMSLNPDKQ 343
            .|....:|....||.::.|  |.......|.:..||.|.:..|:||.:..:.:.|..::|||:.|
Human   275 QDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQ 339

  Fly   344 ELCYQEIQEHIDDDLSNLDVGQLNKLKYLEYFMKETTRLFPSVPIMGREAVQETELANGLILPKG 408
            |.|.:|::..:.|. |::...||.::.|....:|||.||.|:||.:.|:..:.....:|..||.|
Human   340 ERCREEVRGILGDG-SSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAG 403

  Fly   409 AQITIHVFDIHRNAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIGKKYAMQEMKTLM 473
            ..:.:.::.:|.|...|.:|:.|.|.||..||...||.|||:|||||.|||||:::||.|:|..:
Human   404 ITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTI 468

  Fly   474 VVLLKQFKVLKAIDPQK-IVFHTGITLRTQDKIRVKL 509
            .::|..|:|..  ||.: :.|.....|:.::.:.:.|
Human   469 ALILLHFRVTP--DPTRPLTFPNHFILKPKNGMYLHL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p1NP_524828.1 p450 54..509 CDD:278495 120/425 (28%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 120/423 (28%)
heme binding region 447..460 9/12 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.