DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4p1 and LOC100488078

DIOPT Version :9

Sequence 1:NP_524828.1 Gene:Cyp4p1 / 45524 FlyBaseID:FBgn0015037 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_012817051.1 Gene:LOC100488078 / 100488078 -ID:- Length:510 Species:Xenopus tropicalis


Alignment Length:524 Identity:145/524 - (27%)
Similarity:255/524 - (48%) Gaps:65/524 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNT--LDLYGRDHAGVFNYSRE 75
            ||..|::|.:.|     ..:|..:...:|.    |..|...::||.  .:..|:|...:.||:::
 Frog    23 LLLLLYKATQLY-----LKRRFLVAAFSPF----PGPKCHWLYGNAHEFNTDGKDMDIIMNYAKK 78

  Fly    76 RAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLV----------YNFLHPFLRTGLL 130
                     ..|.:...:.|..    |..::.||: ..|.::          |.||.|::..|||
 Frog    79 ---------YPYAYPMWLGNFF----ASLIICHPD-YAKAILSRQDPKDDFGYYFLTPWIGKGLL 129

  Fly   131 TSTGKKWHARRKMLTPTFHFNILNQFQEIFKTESQKFLLQFEGQ--DEVTITLHDVIPRFTLNSI 193
            ..:|:||...|::|||.||:::|..:.::....|...|.:::.:  |:..:.|...:...||:||
 Frog   130 VLSGQKWFQHRRLLTPAFHYDVLKPYVKLMADCSNVMLDKWDKEISDKKPVELFHHVSLMTLDSI 194

  Fly   194 CETAMGVKLDEMAEKGDRYRENFSQIEECFIRRLSNPLLWGDKLFEM----FAAKDFASALDVVH 254
            .:.|.....:......::|.:...::......|.:......|.:|.:    |.   |..||.|.|
 Frog   195 MKCAFSYHSNCQNNSENKYIKAVYELSYLVDHRFTFLPYHSDFIFYLSPHGFR---FRRALKVAH 256

  Fly   255 RFSSEIIAKRRDLL--KDELDKSSSTADDDGFVSKKRFAMLDTLIYAEKD---GLIDHIGICEEV 314
            ..:.::|.:|:..|  ::||:|         ...|:....||.|:.|:.:   ||.|. .:..||
 Frog   257 DHTDKVIKQRKKSLHEQNELEK---------IQQKRHLDFLDILLCAKDENGKGLSDE-DLRAEV 311

  Fly   315 DTLMFEGYDTTSIGLIFGLMNMSLNPDKQELCYQEIQEHIDDDLSNLDVGQLNKLKYLEYFMKET 379
            ||.||||:|||:.|:.:.|..|:..|:.|:.|.:||::.:... ..:|...|.|:.|....:||:
 Frog   312 DTFMFEGHDTTASGISWTLYCMAKYPEHQQKCREEIRDVLGGK-QTVDWDDLGKMPYTTLCIKES 375

  Fly   380 TRLFPSVPIMGREAVQETELANGLILPKGAQITIHVFDIHRNAKYWDSPEEFRPERFLPENVQDR 444
            .||:|.||.:.|:..|.....:|..|||.:.:.:.::.|:|.:..|:.||.|.|.||..||...|
 Frog   376 LRLYPPVPGIARQLTQPITFCDGRSLPKDSMVLLSLYAINRCSSIWEDPEVFDPMRFSAENSAKR 440

  Fly   445 HTYAYVPFSAGQRNCIGKKYAMQEMKTLMVVLLKQFKVL--KAIDPQKIVFHTGITLRTQDKIRV 507
            :::|::|||||.|||||:.:||.|||..:.:.|::|::.  ..|:|   :....:.||:.:.|.:
 Frog   441 NSHAFLPFSAGSRNCIGQNFAMNEMKVALALTLQRFELFPDTGIEP---LTAPQLVLRSLNGIHL 502

  Fly   508 KLVR 511
            ||.|
 Frog   503 KLKR 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4p1NP_524828.1 p450 54..509 CDD:278495 133/479 (28%)
LOC100488078XP_012817051.1 p450 48..502 CDD:278495 135/484 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.