DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and OXR1

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_015128.1 Gene:OXR1 / 855905 SGDID:S000006117 Length:273 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:63/203 - (31%)
Similarity:100/203 - (49%) Gaps:46/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1181 KTEILTEEHREKLCSHLPARAEGYS-WSLIFSTSQHGFALNSLYRKMARLESP---------VLI 1235
            |.::||.|..:::.:.:|.|.:.|: |:|::|..|||.:|:|||..:|    |         .::
Yeast    72 KNKLLTPEMCDEIRTLMPTRIQLYTEWNLLYSLEQHGSSLHSLYSNVA----PDSKEFRRVGYVL 132

  Fly  1236 VIEDTEHNVFGALTSCSLHVSDH--FYGTGESLLYKFNP-------------------------- 1272
            ||:|.::.:|||.::.:.|.::|  :.|.||..|:|.:.                          
Yeast   133 VIKDRKNGIFGAYSNEAFHPNEHRQYTGNGECFLWKLDKVPDVNISEKEESEQEGKEGKEEGDKE 197

  Fly  1273 ---SFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQ-EDF 1333
               .|..:.:||.|.:.|....|.||:|||||.:||..|..|..|.|..|.|||||.|:.: :.|
Yeast   198 ERWRFSGYPYTGVNEFAIYCTSEFLSMGAGDGHYGLLCDDGLLHGVSNPCQTYGNEVLSKEGKKF 262

  Fly  1334 VIKTLECW 1341
            .|..||.|
Yeast   263 SIVALEVW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 62/202 (31%)
OXR1NP_015128.1 OXR1 40..273 CDD:227471 63/203 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343900
Domainoid 1 1.000 78 1.000 Domainoid score I2070
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001020
OrthoInspector 1 1.000 - - oto99911
orthoMCL 1 0.900 - - OOG6_100646
Panther 1 1.100 - - O PTHR23354
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R882
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.