DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and MDR1

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_011614.1 Gene:MDR1 / 852992 SGDID:S000003332 Length:950 Species:Saccharomyces cerevisiae


Alignment Length:385 Identity:73/385 - (18%)
Similarity:131/385 - (34%) Gaps:145/385 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 TDGQG---------VVGGVLLVTPNAVMFDPNVSDPLVIEHGPESYGVIAPMELVVNAAIFHDIA 519
            |||.|         :..|:||:|      :|..|...|              :|:....|..|||
Yeast   652 TDGDGELHREEVLQLSEGLLLLT------EPWKSGRYV--------------DLLTKKRIEDDIA 696

  Fly   520 H--MRVAGGAGQGLNSASGDAEKPEIYYPKPVLVEEDSKELPEQQSLLGEDGN---------KRL 573
            .  ::.:||....:|         :|..|..|.::|:..::.:.:..|....|         |.:
Yeast   697 ENIIKESGGEIATMN---------QIELPTGVTIDEEKYKVEQAERYLKAASNFLQRSFEYAKAV 752

  Fly   574 D--AEIGSLEIADDQ------------ESLCSSTGRDGDAFPKAFDRERVEDSSMEAKDSAKTDA 624
            |  .|:..::::||:            ||:.::...| ...||..|           ..:.:...
Yeast   753 DLAEEVNLIDLSDDEGEEKRTVKQKQLESIKANAALD-PTHPKVID-----------LPTFRMII 805

  Fly   625 LDDEDKKAGLGLSST-RSTLEERRKSLLDHHWAIPSKDRSSEDEGDNESNVTVDSGARVQ----- 683
            |.||..:  |..|:| ||::.      :|.|..|.:|::......|   .:..| |.||.     
Yeast   806 LADETYE--LFFSNTLRSSVH------VDEHVNIDNKNKVLRSMFD---GILAD-GKRVAEQVRR 858

  Fly   684 --DPHSANSSVSGVPLSQPPVAAAAAAAAVAPASAVVPLPPSGIDLEHLEQLSKQSCYDSGIDIR 746
              |..:..||::.|  ...|.|||::..                        :|:..||   |:.
Yeast   859 RVDSVATRSSIASV--ESTPTAAASSIT------------------------TKEEKYD---DLD 894

  Fly   747 EPVPNVQPIPKKTVYSDADIVLSSDW-------------VPPKTIVPTHFSESPPRSTIL 793
            :.....||        :.:.:|.|.|             :..::..|...:.|..:|.::
Yeast   895 DFTSEHQP--------ENEELLQSSWFEIDDANETSTKAIQERSFEPLSANSSEEKSNLI 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733
MDR1NP_011614.1 COG5210 23..531 CDD:227535
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.