DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and TBC1D10A

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_001191169.1 Gene:TBC1D10A / 83874 HGNCID:23609 Length:515 Species:Homo sapiens


Alignment Length:541 Identity:101/541 - (18%)
Similarity:163/541 - (30%) Gaps:180/541 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 AKDDASSSSTHDADGASLSGKSSPVERKLSGDESREKDILEGLRPGSPKPGHIER-------VGG 432
            ||.:..:.....|.|.||||..   |....|.::...|.|..|...|...|..||       :.|
Human     2 AKSNGENGPRAPAAGESLSGTR---ESLAQGPDAATTDELSSLGSDSEANGFAERRIDKFGFIVG 63

  Fly   433 SSQQQQA-----------------EEEANKSD-----DPVITQRFLKINVRHITDG--------- 466
            |...:.|                 :.|:...|     |..:.::..||.:| ...|         
Human    64 SQGAEGAPCPLLHRLEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLR-CQKGIPPSLRGRA 127

  Fly   467 -QGVVGGVLLVTPNAVMFDP---NVSDPLVIEHGPESYGVIAPMELVVNAAI-----FHDIAHMR 522
             |.:.||.:.:..|...||.   :..||..::              |:...:     ||::...|
Human   128 WQYLSGGKVKLQQNPGKFDELDMSPGDPKWLD--------------VIERDLHRQFPFHEMFVSR 178

  Fly   523 VAGGAGQG-----LNSASGDAEKPEIYY---PKPV----------------LVEEDSKELPEQQS 563
              ||.||.     |.:.:  ..:||..|   ..|:                ||:...|.||...|
Human   179 --GGHGQQDLFRVLKAYT--LYRPEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQICEKYLPGYYS 239

  Fly   564 LLGEDGNKRLDAEIGSLEIADDQESLCSSTGRDGDAFPKAFDRERVE------------------ 610
                   ::|:|      |..|.|.|.|...:......|...|::::                  
Human   240 -------EKLEA------IQLDGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFSRTLP 291

  Fly   611 -DSSMEAKDSAKTD---------------ALDDEDK-KAGLGLSSTRSTLEERRKSLLDHHWAI- 657
             .|.:...|....:               ||...:| ||..|...|...|......::...:.: 
Human   292 WSSVLRVWDMFFCEGVKIIFRVGLVLLKHALGSPEKVKACQGQYETIERLRSLSPKIMQEAFLVQ 356

  Fly   658 -----PSKDRSSEDE--------GDNESNVTVDSGARVQDPHSANSSVSGV----PLSQPPVAAA 705
                 |..:|..|.|        .:....:...|..|:   |.|.:.:...    |..||..:..
Human   357 EVVELPVTERQIEREHLIQLRRWQETRGELQCRSPPRL---HGAKAILDAEPGPRPALQPSPSIR 418

  Fly   706 AAAAAVAPASAVVPLPPSGIDLEHLEQLSKQSCYDSGIDIREPVPNVQPIPKKTVYSDADIVLSS 770
            ....|..|.|...|.||.....|..:|:..:...:     :.|.||...:          :..:.
Human   419 LPLDAPLPGSKAKPKPPKQAQKEQRKQMKGRGQLE-----KPPAPNQAMV----------VAAAG 468

  Fly   771 DWVPPKTIVPTHFSESPPRST 791
            |..||:.:.|   .:|.|:.:
Human   469 DACPPQHVPP---KDSAPKDS 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733
TBC1D10ANP_001191169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 13/46 (28%)
TBC 117..320 CDD:214540 39/233 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 403..515 20/102 (20%)
ZipA <403..>502 CDD:331990 20/102 (20%)
Binding to the PDZ domain of EBP50 512..515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.