DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and PAM1

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_197097.1 Gene:PAM1 / 831450 AraportID:AT5G15930 Length:356 Species:Arabidopsis thaliana


Alignment Length:215 Identity:47/215 - (21%)
Similarity:70/215 - (32%) Gaps:92/215 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  1026 IPLPTSVMSYGKNKLRAEYWFSVPKNRVDELYRFINTWVKHLYGELDEEQIKARGFELIQEDTEW 1090
            :||...|..:|  .|:.|:. |.|:       ||..|.....| |.:|:::           |:|
plant    14 VPLLVPVDRFG--FLKQEHG-SSPQ-------RFTKTKSSINY-EKEEKRV-----------TKW 56

  Fly  1091 TKSGTTKAGMGGGSQDGEE----------------ISDLTRE-SWELIKAPFAKTYKIIKTASHA 1138
            .|.      :|.|..|.:.                |.|..|. .|:||                :
plant    57 RKM------IGTGGSDWKHYVRRKPHVVKRRIRKGIPDCLRGLVWQLI----------------S 99

  Fly  1139 ASHDLEMLGGEVLSMSTDEYRKTSLFATGSFDLDFPIPDLIGKTEILTEEHREKLCSHLPARAEG 1203
            .|.||       |.|:...|.:..::.|.:.:||. |.| |.:|          ..||       
plant   100 GSRDL-------LLMNPGVYVQLVIYETSASELDI-IRD-ISRT----------FPSH------- 138

  Fly  1204 YSWSLIFSTSQHGFALNSLY 1223
                 :|...:||....|||
plant   139 -----VFFQKRHGPGQRSLY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 9/42 (21%)
PAM1NP_197097.1 TBC 82..296 CDD:214540 27/119 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.