DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and AT5G06260

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_196244.1 Gene:AT5G06260 / 830513 AraportID:AT5G06260 Length:424 Species:Arabidopsis thaliana


Alignment Length:343 Identity:82/343 - (23%)
Similarity:142/343 - (41%) Gaps:79/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1067 LYGELDEEQIKARGFELI---QEDTEWTKSG--TTKAGMGGGSQDGEEISD-------------L 1113
            |.|.|.|     |.|:::   ::|.:.|...  ..||....|:.|  ||::             |
plant    57 LSGSLGE-----RMFDMVTQRRKDDKMTYEDLVIAKATYEKGTDD--EIAEFIYQTLDVNGNGVL 114

  Fly  1114 TRESWE-----LIKAPF--------AKTYK-----IIKTASHAASHDLEMLGGEVLSMSTDEYRK 1160
            :|...|     ::|:.|        :..||     ::..|:.:.|.|     |....||.:::|.
plant   115 SRSDLESFLVVILKSVFSTESSDAESSDYKKMVDALLNAATFSKSDD-----GSEKGMSFEDFRS 174

  Fly  1161 TSLFA------TGSFDL-------DFPIPDLIGKTEI------LTEEHREKLCSHLPARAEGYSW 1206
            ...|.      .||..:       .:.:|.|:.:..:      |.:|:...:...|| ..|...|
plant   175 WCSFVPTIRKFLGSLLMPPSTVRPGYQVPHLLYEDSVSSDRLLLKKEYAWHIGGALP-HHELVEW 238

  Fly  1207 SLIFSTSQHGFALNSL--YRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYK 1269
            .|::.:|.||.:.|:.  :.....:.:.||| |:|||..|:|...|........|||..:|.|::
plant   239 KLLYHSSVHGQSFNTFLGHTSNTGMSASVLI-IKDTEGYVYGGYASQPWERYSDFYGDMKSFLFQ 302

  Fly  1270 FNPSFKVFHWTG--ENMYFIKGNMESLSIGAGDG------RFGLWLDGDLNQGRSQQCSTYGNEP 1326
            .||...::..||  .|:.:...|..|.:|..|.|      .|||::....:||::.:|:|:|:..
plant   303 LNPKAAIYRPTGANTNIQWCATNFTSENIPNGIGFGGKINHFGLFISASFDQGQTFECTTFGSPS 367

  Fly  1327 LAPQEDFVIKTLECWAFV 1344
            |:.......:.:|||..|
plant   368 LSKTSRIQPEVIECWGIV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 48/177 (27%)
AT5G06260NP_196244.1 EF-hand_7 64..123 CDD:290234 13/60 (22%)
EF-hand_7 99..176 CDD:290234 14/81 (17%)
TLDc 215..385 CDD:214733 48/171 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.