DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and Tldc2

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:XP_038962640.1 Gene:Tldc2 / 502689 RGDID:1561343 Length:217 Species:Rattus norvegicus


Alignment Length:124 Identity:55/124 - (44%)
Similarity:83/124 - (66%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1176 PDLIGKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDT 1240
            |.|...:::|.....::|..|||.|..|:.|:|||.||:.||:|..|||:|.....|||:::.|.
  Rat    42 PQLTEASQVLGASEIKQLSLHLPPRVTGHPWNLIFCTSRDGFSLQRLYRQMEGHSGPVLLLLRDQ 106

  Fly  1241 EHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAG 1299
            :..:|||.:|.:|.:|..||||||:.|:.|:|..|||.|||.|.:|:||:::||.:|:|
  Rat   107 DGQMFGAFSSSALRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 53/118 (45%)
Tldc2XP_038962640.1 TLDc 48..>165 CDD:214733 52/116 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335615
Domainoid 1 1.000 168 1.000 Domainoid score I3722
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D384247at33208
OrthoFinder 1 1.000 - - FOG0001020
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100646
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.