DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and CG5916

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:118 Identity:25/118 - (21%)
Similarity:43/118 - (36%) Gaps:50/118 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  1118 WELIKAPFAKTYKIIKTASHA--ASHDLEMLGGEVLSMSTDEYRKTSLFATGSFDLDFPIPDLIG 1180
            |:.:   ||:.|||:..|:..  .:|...:||.:.::...:.:|.|.:                 
  Fly   249 WDCV---FAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMI----------------- 293

  Fly  1181 KTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGF--ALNSLYRKMARLES 1231
            :..|:|:      |                    |||  |:.||..|.:.|||
  Fly   294 QDNIVTD------C--------------------HGFVEAMFSLRLKRSELES 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 13/52 (25%)
CG5916NP_001287357.1 TBC 67..276 CDD:214540 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.