DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and Tldc2

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:XP_006499899.1 Gene:Tldc2 / 383766 MGIID:2686178 Length:261 Species:Mus musculus


Alignment Length:164 Identity:79/164 - (48%)
Similarity:112/164 - (68%) Gaps:0/164 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1178 LIGKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEH 1242
            ::|.:||...:...:|..|||.|..|:.|||:|.||:.||:|..|||:|.....|||:::.|.:.
Mouse    95 VLGASEIKQLQLHLQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQMEGHSGPVLLLLRDQDG 159

  Fly  1243 NVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWL 1307
            .:|||.:|.::.:|..||||||:.|:.|:|..|||.|||.|.:|:||:::||.:|:|.|:|||||
Mouse   160 QMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSGSGQFGLWL 224

  Fly  1308 DGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECW 1341
            ||||..|.|..|:|:.||.||.:|.|.||.||.|
Mouse   225 DGDLYHGGSYPCATFNNEVLARREQFCIKELEAW 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 78/160 (49%)
Tldc2XP_006499899.1 TLDc 115..261 CDD:214733 73/144 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001020
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100646
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R882
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.670

Return to query results.
Submit another query.