DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and CG5149

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_609110.1 Gene:CG5149 / 34013 FlyBaseID:FBgn0031904 Length:448 Species:Drosophila melanogaster


Alignment Length:288 Identity:69/288 - (23%)
Similarity:113/288 - (39%) Gaps:84/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1129 YKIIKTASHAAS----------HDLEMLGGEVLSMSTDEYRKTSLFATGSF-----DLDFPIP-D 1177
            |.:||:..|..|          ||        |..:|.| |..:.||.|..     :|:..:| |
  Fly   121 YSVIKSYVHLESTAKNSGIKEWHD--------LGFNTTE-RSAATFAKGLMRNLGKELEHTMPND 176

  Fly  1178 LIGK--------TEILTEEHREKLCSH---------------LPA-------------------- 1199
            .:.:        .:|..|...:..|.|               |||                    
  Fly   177 ALERWLHVTPQFLQIWREVFSQLYCRHGGSKRNIIKEMEIPILPALCDAPQNSHYRPIIELPHVL 241

  Fly  1200 -------RAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSD 1257
                   |...:.|..:||:..:|.:.:::..|:.. :.|.|..|||.:..:||...|.:..|..
  Fly   242 YINAQLPREHRHKWRFLFSSKINGESFSTMLGKVLD-KGPTLFFIEDEDQYIFGGYASETWSVKP 305

  Fly  1258 HFYGTGESLLYKFNPSFKVFHWTGENMY--FIKGNMESLSIGAG-DGRF---GLWLDGDLNQGRS 1316
            .|.|...||||..:|:.:.|..|..|.:  ::..|.:::..|.| .|:|   |||:|.....|:|
  Fly   306 QFGGDDSSLLYTLSPAMRCFSATTYNNHYQYLNLNQQTMPNGLGMGGQFDFWGLWIDCSFGDGQS 370

  Fly  1317 -QQCSTYGN-EPLAPQEDFVIKTLECWA 1342
             :.|:||.: ..|:.::.|.|:.:|.||
  Fly   371 VESCTTYRDYVQLSKRKQFKIRNMEVWA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 52/211 (25%)
CG5149NP_609110.1 DMP12 11..>67 CDD:293384
TLDc 232..400 CDD:214733 45/168 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23354
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.