DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and Meak7

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:XP_038954127.1 Gene:Meak7 / 307901 RGDID:1308461 Length:467 Species:Rattus norvegicus


Alignment Length:210 Identity:64/210 - (30%)
Similarity:94/210 - (44%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1158 YRKTSLFATGSFDLDFPIPD-----------------LIGKTEILTEEHREKLCSHLPARAEGYS 1205
            :|...|.|: ||||...:|:                 :|..:..|..|||:  |           
  Rat   225 HRGLCLLAS-SFDLSTLVPECHVDGGRPSESILDVLSVIYLSSHLAVEHRQ--C----------- 275

  Fly  1206 WSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKF 1270
            |.|:|||..||.:.:.|. .:...:.|.|||:||.:..|||...|||..|...|.|..:..|:..
  Rat   276 WRLLFSTQLHGQSFSQLC-SLITSQGPSLIVLEDRDGYVFGGFASCSWEVKPQFQGDNKCFLFSI 339

  Fly  1271 NPSFKVFHWTGENMYFIKGN--MESLSIGAGDG----RFGLWLDGDLNQGRSQ---QCSTYGNEP 1326
            .|....:..||.|.:|:..|  .:::..|.|.|    .||||:..|..:|.|:   .|:||.:..
  Rat   340 APRMATYTPTGYNNHFMYLNYGQQTMPNGLGMGGQHHYFGLWVAADFGKGHSKAKPACTTYSSPQ 404

  Fly  1327 LAPQEDFVIKTLECW 1341
            |:.||||..:.:|.|
  Rat   405 LSAQEDFQFEKMEVW 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 55/169 (33%)
Meak7XP_038954127.1 TLDc 254..422 CDD:214733 56/180 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.