DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and mug63

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_594286.1 Gene:mug63 / 2541938 PomBaseID:SPAC8C9.16c Length:188 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:51/175 - (29%)
Similarity:86/175 - (49%) Gaps:14/175 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1181 KTEILTEEHREKLCSHLPAR-AEGYSWSLIFSTSQHGFALNSLY----RKMARLESP---VLIVI 1237
            |..::|:|....:..:|||| |...:|..|:|....|.:|.::|    ::.||...|   .::.:
pombe    11 KDGLITDELASHIVENLPARYASAETWKRIYSLQHDGASLQTMYLACEKEKARSGHPKGACILAV 75

  Fly  1238 EDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHW--TGENMYFIKGNMESLSIGAGD 1300
            .||:.:|||......|..:.|::|:.|:.|:|:.|..|..|:  .|.:.:........|:.|.|:
pombe    76 RDTDGDVFGVFIPDYLIPAPHYFGSEETFLWKYFPPKKYVHYPFVGNSNFVAYCTKSFLAFGGGN 140

  Fly  1301 GRFGLWLDGDLNQGRSQQCSTYGNEPLA----PQEDFVIKTLECW 1341
            ||:.|||||.|....|.:...:.|.||:    |.:...|..:|.|
pombe   141 GRYSLWLDGSLEYAYSSRTPAFENNPLSYRGCPDQRIQIVDIELW 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 50/174 (29%)
mug63NP_594286.1 OXR1 1..188 CDD:227471 51/175 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I2657
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001020
OrthoInspector 1 1.000 - - otm47037
orthoMCL 1 0.900 - - OOG6_100646
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R882
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.