DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and TLDC2

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_542195.1 Gene:TLDC2 / 140711 HGNCID:16112 Length:215 Species:Homo sapiens


Alignment Length:170 Identity:82/170 - (48%)
Similarity:114/170 - (67%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1172 DFPIPDLIGKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIV 1236
            |..:|.|...:::|:.....:|..|.|.|..|:.|||:|.||:.||:|.||||:|.....|||:|
Human    43 DPTVPQLTEASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLV 107

  Fly  1237 IEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDG 1301
            :.|.:..:|||.:|.::.:|..||||||:.|:.|:|..|||.|||.|.:|:||:::||.:|:|.|
Human   108 LRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSG 172

  Fly  1302 RFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECW 1341
            ||||||||||.:|.|..|.|:.||.||.||.|.|:.||.|
Human   173 RFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAW 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 79/160 (49%)
TLDC2NP_542195.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 1/2 (50%)
TLDc 53..212 CDD:214733 78/158 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D384247at33208
OrthoFinder 1 1.000 - - FOG0001020
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100646
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R882
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.680

Return to query results.
Submit another query.