powered by:
Protein Alignment mtd and C31H2.14
DIOPT Version :9
Sequence 1: | NP_001246928.1 |
Gene: | mtd / 45467 |
FlyBaseID: | FBgn0013576 |
Length: | 1344 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379753.1 |
Gene: | C31H2.14 / 13220525 |
WormBaseID: | WBGene00206484 |
Length: | 73 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 14/61 - (22%) |
Similarity: | 22/61 - (36%) |
Gaps: | 17/61 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 566 GEDGNKRLDAEIGSLEIADDQESLCSSTGRDGDAFPKAFDRERVEDSSME-AKDSAKTDAL 625
||..:|| .||........:.|.|:.:..|.:.:: ||.:|..|.|
Worm 17 GEPASKR----------------HCSQLSEKSSRYSKPFNGQLEEKNKVQPAKRNAPQDNL 61
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
mtd | NP_001246928.1 |
LysM |
271..371 |
CDD:224306 |
|
LysM |
329..371 |
CDD:279777 |
|
TLDc |
1182..1344 |
CDD:214733 |
|
C31H2.14 | NP_001379753.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5142 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.