DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and AgaP_AGAP010235

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:XP_319423.3 Gene:AgaP_AGAP010235 / 1279658 VectorBaseID:AGAP010235 Length:589 Species:Anopheles gambiae


Alignment Length:170 Identity:50/170 - (29%)
Similarity:88/170 - (51%) Gaps:20/170 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1193 LCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSC---SLH 1254
            |.|.||.|...|...|:::|.:||.:|.:.|.::.:.| |.|::|:...:.||||..|.   ..:
Mosquito   420 LWSWLPVRITMYQPILLYTTEEHGCSLTTFYVRVEQHE-PTLLMIKTCNNEVFGAYCSSRWFERN 483

  Fly  1255 VSDH------FYGTGESLLYKFNPSFKVFHWTG---------ENMYFIKGNMESLSIGAGDGRFG 1304
            :.|.      ::||||:.|:...|....:.|.|         .:..|:..:.:.::||.|:|: .
Mosquito   484 LKDDRGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDTGLGHASELFMAADSKMITIGGGEGQ-A 547

  Fly  1305 LWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKTLECWAFV 1344
            :|:|.::..|::.:|.|:.|.||....||.|:.||.:.||
Mosquito   548 IWMDENIRFGKTDRCQTFNNPPLCASGDFEIRVLEVYGFV 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 48/168 (29%)
AgaP_AGAP010235XP_319423.3 RabGAP-TBC 147..297 CDD:295329
TLDc 416..587 CDD:214733 48/168 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.