DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and LOC101885192

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:XP_005174588.3 Gene:LOC101885192 / 101885192 -ID:- Length:160 Species:Danio rerio


Alignment Length:134 Identity:44/134 - (32%)
Similarity:63/134 - (47%) Gaps:29/134 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 RDTLTSVAARFDTTPSELTHLNRLNSSFIYPGQQLLVPDKSAKDDASSSSTHDADGASLSGKSSP 398
            :|||.|:|..|:.||::|.|||||.|..:.|||:|.|||:              |.|....:.|.
Zfish     5 KDTLNSIALHFNITPNKLVHLNRLYSHSVVPGQKLFVPDE--------------DEAKCVSQVSD 55

  Fly   399 VERKLSGDESRE-KDILEGLRPGSPKPGHIERVGGSSQQQQAEEEANKSDDPVITQRFLKINVRH 462
            ..:.|:..||.| ||.....|||.|    :.|          |......|:...|.:|:|::.::
Zfish    56 CSKHLAASESTEIKDGEYSSRPGRP----VCR----------ETSPLSEDESPATVKFIKMSCKY 106

  Fly   463 ITDG 466
            .|||
Zfish   107 FTDG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306 19/36 (53%)
LysM 329..371 CDD:279777 19/36 (53%)
TLDc 1182..1344 CDD:214733
LOC101885192XP_005174588.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D384247at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.