DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and tbc1d24

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:XP_009295920.3 Gene:tbc1d24 / 100536073 ZFINID:ZDB-GENE-050809-65 Length:610 Species:Danio rerio


Alignment Length:223 Identity:58/223 - (26%)
Similarity:90/223 - (40%) Gaps:64/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1182 TEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFG 1246
            :||::.:....:.|.:|.|.......|:|:||.||.:||..|......| |.|::|..|:..|.|
Zfish   385 SEIVSAKEIRDIWSWIPERFALCQPQLLFTTSTHGCSLNRFYAHCEGYE-PTLLLIRTTDREVCG 448

  Fly  1247 ALTSCSLHVSDH------FYGTGESLLYKFNPSFKVFHW-------------------------- 1279
            |..|........      |:||||..:::..|..:.:.|                          
Zfish   449 AFLSTDWEERKRGGNKLSFFGTGECFVFRMKPEMERYEWVIIKHPELAKSAQSAEDQSSVEDNGT 513

  Fly  1280 --TGENM---------------------------YFIKGNMESLSIGAGDGRFGLWLDGDLNQGR 1315
              :||.:                           .|:.||::|:.||.|||. .|::|.:||.||
Zfish   514 PHSGETLEKPTTDSSHLSPFLSARHFNLNSRNTSMFMAGNVDSIIIGGGDGN-ALYIDSELNHGR 577

  Fly  1316 SQQCSTYGNEPLAPQEDFVIKTLECWAF 1343
            :::|.|:.|.||. .|.|.:..||.|.|
Zfish   578 TERCLTFDNPPLC-AESFQVALLEVWGF 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 58/223 (26%)
tbc1d24XP_009295920.3 RabGAP-TBC <157..295 CDD:306939
TLDc 385..604 CDD:214733 57/221 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.