Sequence 1: | NP_001246928.1 | Gene: | mtd / 45467 | FlyBaseID: | FBgn0013576 | Length: | 1344 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009295920.3 | Gene: | tbc1d24 / 100536073 | ZFINID: | ZDB-GENE-050809-65 | Length: | 610 | Species: | Danio rerio |
Alignment Length: | 223 | Identity: | 58/223 - (26%) |
---|---|---|---|
Similarity: | 90/223 - (40%) | Gaps: | 64/223 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 1182 TEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFG 1246
Fly 1247 ALTSCSLHVSDH------FYGTGESLLYKFNPSFKVFHW-------------------------- 1279
Fly 1280 --TGENM---------------------------YFIKGNMESLSIGAGDGRFGLWLDGDLNQGR 1315
Fly 1316 SQQCSTYGNEPLAPQEDFVIKTLECWAF 1343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mtd | NP_001246928.1 | LysM | 271..371 | CDD:224306 | |
LysM | 329..371 | CDD:279777 | |||
TLDc | 1182..1344 | CDD:214733 | 58/223 (26%) | ||
tbc1d24 | XP_009295920.3 | RabGAP-TBC | <157..295 | CDD:306939 | |
TLDc | 385..604 | CDD:214733 | 57/221 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5142 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |