DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtd and ndufaf4

DIOPT Version :9

Sequence 1:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster
Sequence 2:NP_001135673.1 Gene:ndufaf4 / 100216234 XenbaseID:XB-GENE-5852768 Length:177 Species:Xenopus tropicalis


Alignment Length:131 Identity:31/131 - (23%)
Similarity:51/131 - (38%) Gaps:25/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 DVSSLSRSVDNLAIPVRRSKSRSVDHGLAAPFDLDS-LRSKVE---QRFESVDKLSRQKSSLPTI 324
            |:....|:.|||.:  .|.|...||     .:|..| :::||.   |:...:.|.:..:.||..:
 Frog    49 DIEDKIRNKDNLLL--TRLKEVYVD-----SYDPSSGVQTKVSRSAQKEHRLPKFAMNRESLMGV 106

  Fly   325 PTISYTVGNRDTLTSVAA--RFDTTP--------SELTHLNRLNS----SFIYPGQQLLVPDKSA 375
            ...|...||...|.::..  ....:|        ||..||:..|:    .:..|....::|.|..
 Frog   107 DVESIPKGNISVLEALTLLNNHKNSPETWTAEKISEDYHLDLKNTQSLLEYFIPFNVKIIPPKDK 171

  Fly   376 K 376
            |
 Frog   172 K 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mtdNP_001246928.1 LysM 271..371 CDD:224306 26/117 (22%)
LysM 329..371 CDD:279777 10/55 (18%)
TLDc 1182..1344 CDD:214733
ndufaf4NP_001135673.1 UPF0240 2..169 CDD:369079 29/126 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.