DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTNR1B and AstA-R2

DIOPT Version :9

Sequence 1:NP_005950.1 Gene:MTNR1B / 4544 HGNCID:7464 Length:362 Species:Homo sapiens
Sequence 2:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster


Alignment Length:337 Identity:85/337 - (25%)
Similarity:153/337 - (45%) Gaps:53/337 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    37 PWVAPALSAVLIVTTAVDVVGNLLVILSVLRNRKLRNAGNLFLVSLALADL--VVAFYPYPLILV 99
            ||:......|:.:|   ...|||||||.|:.|..:|:..||.:|:||.|||  |:...|:.....
  Fly    38 PWIVGFFFGVIAIT---GFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDY 99

Human   100 AIFYDGWALGEEHCKASAFVMGLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLI 164
            .::|  |..|...|::..:::.::...|::.:..::|:|:..:.|.:....:.....|.:.|..:
  Fly   100 MVYY--WPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTL 162

Human   165 WLLTVVALLPNFFVGS--LEYDPR---IYS-CTFIQT---ASTQYTAAVVVIHFLLPIAVVSFCY 220
            |::.:|..:|..|...  ::||.:   .|. |||...   ....|.....:..:|||:.::|..|
  Fly   163 WIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFFISSYLLPLMIISGLY 227

Human   221 ----LRIW------VLVLQARRKAKPESRLCLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVA 275
                :|:|      .:..:::|..|..:||            :.||.:.||..|.|:..|.|..:
  Fly   228 MRMIMRLWRQGTGVRMSKESQRGRKRVTRL------------VVVVVIAFASLWLPVQLILLLKS 280

Human   276 INPQEMAPQIPEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRRE-YKRILLALWNPRHCIQDASKG 339
            ::..|........:.||:..|||.:||:|.::|..|::|||:. ||.:        :|      .
  Fly   281 LDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAV--------NC------S 331

Human   340 SHAEGLQSPAPP 351
            |..:...|..||
  Fly   332 SRYQNYTSDLPP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTNR1BNP_005950.1 7tm_4 48..>192 CDD:304433 39/151 (26%)
7tm_1 57..308 CDD:278431 69/271 (25%)
7tm_4 <131..>261 CDD:304433 29/148 (20%)
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 32/121 (26%)
7tm_1 55..313 CDD:278431 69/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.