DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment can and RGD1563991

DIOPT Version :9

Sequence 1:NP_524827.1 Gene:can / 45432 FlyBaseID:FBgn0011569 Length:942 Species:Drosophila melanogaster
Sequence 2:XP_017457783.1 Gene:RGD1563991 / 367797 RGDID:1563991 Length:255 Species:Rattus norvegicus


Alignment Length:268 Identity:95/268 - (35%)
Similarity:137/268 - (51%) Gaps:14/268 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 RTLYGHQGPVYGCSFNPEDRFLITCSEDFSVRLWCLLSWSCVVIFSGHLAPVCFVVFAPRGYYFA 684
            :.|.||.||||...|..:...|::||||.|:|.|.|.|::..|::.||..||..|..:|...|||
  Rat     2 KILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISPYSLYFA 66

  Fly   685 TASDDCTARVWMQDNTKPARILQGHLAELGVCLFHPNRHYMATGSADCTVRIWDIVKAVQVRIFR 749
            :.|.|.|||:|..|.|.|.||..||||::....||||.:|:||||.|.|||:|...:...||:|.
  Rat    67 SGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFT 131

  Fly   750 GHKSRITALIYSICGRYLVSGGDDNLIMIWDTANEILMQFFDHHKASINTMEISLDNNILVVGGQ 814
            ||:..:.:|.:|..|:||.|.|:|..:.:||.|:..|.:....|..||.::..|.|:.::.....
  Rat   132 GHRGPVLSLSFSPNGKYLASAGEDQRLELWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASM 196

  Fly   815 DCQLTLWDFEQVIKNYLNRAKISMKNQAGTQESSANNLLVSSFFTKGEPFYMIRFTRRNLLLGFC 879
            |..:.:||......|  ..|..|.....|......:|:|            .::|...||||...
  Rat   197 DNSVRVWDIRSTCCN--TPADGSSGELVGVYTGQMSNVL------------SVQFMACNLLLVTG 247

  Fly   880 VTPREFEN 887
            :|....|:
  Rat   248 ITQENQEH 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canNP_524827.1 TAF5_NTD2 320..453 CDD:176269
WD40 <503..829 CDD:225201 82/208 (39%)
WD40 repeat 591..624 CDD:293791 1/3 (33%)
WD40 619..>823 CDD:238121 81/202 (40%)
WD40 repeat 629..666 CDD:293791 14/36 (39%)
WD40 repeat 672..708 CDD:293791 16/35 (46%)
WD40 repeat 713..749 CDD:293791 16/35 (46%)
WD40 repeat 760..790 CDD:293791 11/29 (38%)
RGD1563991XP_017457783.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D230914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.