DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment can and Wdr38

DIOPT Version :9

Sequence 1:NP_524827.1 Gene:can / 45432 FlyBaseID:FBgn0011569 Length:942 Species:Drosophila melanogaster
Sequence 2:XP_575125.6 Gene:Wdr38 / 366035 RGDID:1562587 Length:299 Species:Rattus norvegicus


Alignment Length:271 Identity:80/271 - (29%)
Similarity:112/271 - (41%) Gaps:37/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   556 VICATFSEGNSMLALGTVSSKVYVFSLKPSKLVQVKAAQWLKNLDTGMAGVDKDMIDPIKKFTRR 620
            |.|:.||.....|...:....|||:..|..:|:      |                         
  Rat    24 VNCSAFSPDGRNLITASDDGCVYVWGTKSGRLL------W------------------------- 57

  Fly   621 TLYGHQGPVYGCSFNPEDRFLITCSEDFSVRLWCLLSWSCVVIFSGHLAPVCFVVFAPRGYYFAT 685
            .|.||:|||..|.|:|:.|.:.:.|.|.::|||.:....|:.:..||...|..|.|:|.....|:
  Rat    58 RLAGHKGPVKSCRFSPDGRLVASSSCDHTIRLWDVAKAKCLHVLKGHQRSVETVSFSPDSKQLAS 122

  Fly   686 ASDDCTARVWMQDNTKPARILQGHLAELGVCLFHPNRHYMATGSADCTVRIWDI---VKAVQVRI 747
            ...|....:|...:.:..|.|.||...:....|.|....:||||.|.||.|||:   ..||..|.
  Rat   123 GGWDKRVILWEVQSGRNVRFLPGHCDSIQSSDFSPTSDSLATGSWDSTVHIWDLRASSPAVSFRN 187

  Fly   748 FRGHKSRITALIYSICGRYLVSGGDDNLIMIW-DTANEILMQFFDHHKASINTMEISLDNNILVV 811
            ..||...|:.|.||..| .|.||..|..:.|| .|.|.:|:| ...|...:|::..|.|...|..
  Rat   188 LEGHTGNISCLKYSASG-LLASGSWDKTVRIWKPTTNNLLLQ-LRGHATWVNSLAFSPDELKLAS 250

  Fly   812 GGQDCQLTLWD 822
            .|....:.:||
  Rat   251 AGYSRMVKVWD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canNP_524827.1 TAF5_NTD2 320..453 CDD:176269
WD40 <503..829 CDD:225201 80/271 (30%)
WD40 repeat 591..624 CDD:293791 2/32 (6%)
WD40 619..>823 CDD:238121 69/208 (33%)
WD40 repeat 629..666 CDD:293791 11/36 (31%)
WD40 repeat 672..708 CDD:293791 8/35 (23%)
WD40 repeat 713..749 CDD:293791 15/38 (39%)
WD40 repeat 760..790 CDD:293791 13/30 (43%)
Wdr38XP_575125.6 WD40 <13..298 CDD:225201 80/271 (30%)
WD40 20..298 CDD:238121 80/271 (30%)
WD40 repeat 26..61 CDD:293791 11/65 (17%)
WD40 repeat 67..103 CDD:293791 10/35 (29%)
WD40 repeat 108..144 CDD:293791 8/35 (23%)
WD40 repeat 151..189 CDD:293791 15/37 (41%)
WD40 repeat 195..230 CDD:293791 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0263
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.