DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ox and QCR9

DIOPT Version :9

Sequence 1:NP_476985.1 Gene:ox / 45401 FlyBaseID:FBgn0011227 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_011699.1 Gene:QCR9 / 853095 SGDID:S000003415 Length:66 Species:Saccharomyces cerevisiae


Alignment Length:50 Identity:21/50 - (42%)
Similarity:29/50 - (57%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDIKGK 53
            :|.|.|||.:.:...|.|.||.|:...|....:.:|..||||||||:|.:
Yeast     6 LYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKAR 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxNP_476985.1 UCR_UQCRX_QCR9 2..54 CDD:283112 21/49 (43%)
QCR9NP_011699.1 UCR_UQCRX_QCR9 4..56 CDD:398828 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I2889
eggNOG 1 0.900 - - E1_KOG3494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I1836
Isobase 1 0.950 - 0 Normalized mean entropy S1219
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005386
OrthoInspector 1 1.000 - - oto99251
orthoMCL 1 0.900 - - OOG6_104587
Panther 1 1.100 - - LDO PTHR12980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1051
SonicParanoid 1 1.000 - - X4934
TreeFam 1 0.960 - -
1312.800

Return to query results.
Submit another query.