DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ox and AT3G52730

DIOPT Version :9

Sequence 1:NP_476985.1 Gene:ox / 45401 FlyBaseID:FBgn0011227 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001327411.1 Gene:AT3G52730 / 824439 AraportID:AT3G52730 Length:79 Species:Arabidopsis thaliana


Alignment Length:44 Identity:18/44 - (40%)
Similarity:24/44 - (54%) Gaps:9/44 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWK 48
            |..:.:|.|.|...|||.|||.|||:|.       |::  |||:
plant    17 YKLIMRRNSVYVTFIIAGAFFGERAVDY-------GVH--KLWE 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxNP_476985.1 UCR_UQCRX_QCR9 2..54 CDD:283112 18/44 (41%)
AT3G52730NP_001327411.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624769at2759
OrthoFinder 1 1.000 - - FOG0005386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104587
Panther 1 1.100 - - LDO PTHR12980
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.