DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ox and Uqcr10

DIOPT Version :9

Sequence 1:NP_476985.1 Gene:ox / 45401 FlyBaseID:FBgn0011227 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001163936.1 Gene:Uqcr10 / 685322 RGDID:1595126 Length:64 Species:Rattus norvegicus


Alignment Length:52 Identity:30/52 - (57%)
Similarity:40/52 - (76%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDIKGKYE 55
            :|:.||:||||:|:.|..||.|||||.|..:.|:::.||:|||||.||.|||
  Rat    10 LYSLLFRRTSTFALTIAVSALFFERAFDQGADAVYDYINEGKLWKHIKHKYE 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxNP_476985.1 UCR_UQCRX_QCR9 2..54 CDD:283112 27/49 (55%)
Uqcr10NP_001163936.1 UCR_UQCRX_QCR9 8..60 CDD:398828 27/49 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11348
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5356
OMA 1 1.010 - - QHG49167
OrthoDB 1 1.010 - - D1624769at2759
OrthoFinder 1 1.000 - - FOG0005386
OrthoInspector 1 1.000 - - oto96225
orthoMCL 1 0.900 - - OOG6_104587
Panther 1 1.100 - - LDO PTHR12980
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4934
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.