DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ox and Uqcr10

DIOPT Version :9

Sequence 1:NP_476985.1 Gene:ox / 45401 FlyBaseID:FBgn0011227 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001349808.1 Gene:Uqcr10 / 66152 MGIID:1913402 Length:64 Species:Mus musculus


Alignment Length:45 Identity:23/45 - (51%)
Similarity:32/45 - (71%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKG-KLW 47
            :|:.||:||||:|:.|...|.|||||.|..:.||:|.||:| :.|
Mouse    10 LYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGVRAW 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxNP_476985.1 UCR_UQCRX_QCR9 2..54 CDD:283112 23/45 (51%)
Uqcr10NP_001349808.1 UCR_UQCRX_QCR9 10..54 CDD:310162 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10137
eggNOG 1 0.900 - - E1_KOG3494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5350
Isobase 1 0.950 - 0 Normalized mean entropy S1219
OMA 1 1.010 - - QHG49167
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005386
OrthoInspector 1 1.000 - - oto92663
orthoMCL 1 0.900 - - OOG6_104587
Panther 1 1.100 - - LDO PTHR12980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1051
SonicParanoid 1 1.000 - - X4934
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.