Sequence 1: | NP_476985.1 | Gene: | ox / 45401 | FlyBaseID: | FBgn0011227 | Length: | 55 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037519.2 | Gene: | UQCR10 / 29796 | HGNCID: | 30863 | Length: | 63 | Species: | Homo sapiens |
Alignment Length: | 52 | Identity: | 30/52 - (57%) |
---|---|---|---|
Similarity: | 39/52 - (75%) | Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDIKGKYE 55 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ox | NP_476985.1 | UCR_UQCRX_QCR9 | 2..54 | CDD:283112 | 27/49 (55%) |
UQCR10 | NP_037519.2 | UCR_UQCRX_QCR9 | 10..60 | CDD:368406 | 27/49 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 63 | 1.000 | Domainoid score | I10230 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3494 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 65 | 1.000 | Inparanoid score | I5363 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG49167 | |
OrthoDB | 1 | 1.010 | - | - | D1624769at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0005386 | |
OrthoInspector | 1 | 1.000 | - | - | oto89095 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_104587 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR12980 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1051 |
SonicParanoid | 1 | 1.000 | - | - | X4934 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
14 | 13.870 |