DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ox and UQCR10

DIOPT Version :9

Sequence 1:NP_476985.1 Gene:ox / 45401 FlyBaseID:FBgn0011227 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_037519.2 Gene:UQCR10 / 29796 HGNCID:30863 Length:63 Species:Homo sapiens


Alignment Length:52 Identity:30/52 - (57%)
Similarity:39/52 - (75%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDIKGKYE 55
            :|:.||:||||:|:.||....|||||.|..:.||::.||:|||||.||.|||
Human    10 LYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYE 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxNP_476985.1 UCR_UQCRX_QCR9 2..54 CDD:283112 27/49 (55%)
UQCR10NP_037519.2 UCR_UQCRX_QCR9 10..60 CDD:368406 27/49 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10230
eggNOG 1 0.900 - - E1_KOG3494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5363
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49167
OrthoDB 1 1.010 - - D1624769at2759
OrthoFinder 1 1.000 - - FOG0005386
OrthoInspector 1 1.000 - - oto89095
orthoMCL 1 0.900 - - OOG6_104587
Panther 1 1.100 - - LDO PTHR12980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1051
SonicParanoid 1 1.000 - - X4934
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.