DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ox and C14B9.10

DIOPT Version :9

Sequence 1:NP_476985.1 Gene:ox / 45401 FlyBaseID:FBgn0011227 Length:55 Species:Drosophila melanogaster
Sequence 2:NP_001379666.1 Gene:C14B9.10 / 259519 WormBaseID:WBGene00015755 Length:60 Species:Caenorhabditis elegans


Alignment Length:49 Identity:17/49 - (34%)
Similarity:27/49 - (55%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VIYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDIK 51
            ::|||:.:|.||..:|....|:.|...|:..:...::..|..|.|||||
 Worm     6 IVYNTVSRRFSTILLASAFGAYTFNYTLEGLTNFYWDTKNSNKQWKDIK 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxNP_476985.1 UCR_UQCRX_QCR9 2..54 CDD:283112 17/49 (35%)
C14B9.10NP_001379666.1 UCR_UQCRX_QCR9 5..57 CDD:398828 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104587
Panther 1 1.100 - - LDO PTHR12980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.