powered by:
Protein Alignment ox and RGD2320734
DIOPT Version :9
Sequence 1: | NP_476985.1 |
Gene: | ox / 45401 |
FlyBaseID: | FBgn0011227 |
Length: | 55 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038949900.1 |
Gene: | RGD2320734 / 100361126 |
RGDID: | 2320734 |
Length: | 64 |
Species: | Rattus norvegicus |
Alignment Length: | 52 |
Identity: | 28/52 - (53%) |
Similarity: | 37/52 - (71%) |
Gaps: | 0/52 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDIKGKYE 55
:|:.||.||||:|:.|..|:.|||||.|..:.||::...:|||||.||.|||
Rat 10 LYSLLFHRTSTFALTIAVSSLFFERAFDQGADAIYDHSKEGKLWKHIKHKYE 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1624769at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.