DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrpRS and TrpRS-m

DIOPT Version :9

Sequence 1:NP_524826.1 Gene:TrpRS / 45399 FlyBaseID:FBgn0010803 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001262001.1 Gene:TrpRS-m / 39989 FlyBaseID:FBgn0036763 Length:665 Species:Drosophila melanogaster


Alignment Length:337 Identity:77/337 - (22%)
Similarity:132/337 - (39%) Gaps:84/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PFYLYTGRGPSSGSLHVGHLVPFIMTKWLQETFDVPLVIQLTDDEKTL----WKDLKVEDAIKLG 176
            |..:::|..| :||||:|:.:..: .||:|        :|...|:.|:    ...:.:.....|.
  Fly    79 PRKVFSGIQP-TGSLHLGNYLGAV-RKWVQ--------LQNARDDVTVCIVDLHSITMPHNPPLL 133

  Fly   177 REN----AKDIVAIGFDVNKTFIF------NNLEFVGKCPAMYQNIIRIQKCVTFNQVKGIFGFG 231
            |||    |..::|.|.|..|:.:|      .:.||.....:: ..:.|:.:...|.:...:.   
  Fly   134 RENIFTMAATLLACGIDPTKSTLFVQSAVAEHAEFNWILSSL-TTMPRLAQLPQFREKSRLL--- 194

  Fly   232 DSDI-IGKIGFPAAQAAPAISSTFPFIFGNRKVHCLIPCAIDQDPYFRMTRDVA----PRLG--F 289
             .|: :|...:|..|||.        |...:..|  :|...||..:.::.:.:|    .|.|  |
  Fly   195 -KDVPLGLYVYPVLQAAD--------IMLYKSTH--VPVGADQIQHIQLAQHLARIYNGRYGETF 248

  Fly   290 PKCALI----HSTFFPALQGAKTKMSASDQN--SAVYLTDTPKQIKNKINK--------YAFSGG 340
            |.|..|    .::...:|:....|||.|:.|  :.:.|.|:|..|..||.|        ..::.|
  Fly   249 PVCTAIIEDGDASRVLSLRDPSKKMSKSEANPKATINLCDSPDLITQKIKKAVTDFTSDITYNPG 313

  Fly   341 RVSVEEHRKLGGVPEV-----DVSYQLLKFFLEDDAKLEEVRVAYSKGEMLTGEIKKLAVETLTP 400
                    |..||..:     .|:.|.:|..:.:.|.|:..:        ....:.:..||.|.|
  Fly   314 --------KRAGVSNLVNIHAQVTGQSIKTVVNEAATLDTAK--------YKDRVAEAVVEHLRP 362

  Fly   401 IVEQ---HQAAR 409
            |.||   |...|
  Fly   363 IREQIHHHMTKR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrpRSNP_524826.1 PLN02486 45..426 CDD:178104 77/337 (23%)
trpS 115..422 CDD:272975 77/337 (23%)
TrpRS-mNP_001262001.1 PRK00927 82..406 CDD:234866 76/334 (23%)
TrpRS_core 82..359 CDD:173903 68/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.