DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrpRS and wars

DIOPT Version :9

Sequence 1:NP_524826.1 Gene:TrpRS / 45399 FlyBaseID:FBgn0010803 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_017207181.1 Gene:wars / 108179007 -ID:- Length:262 Species:Danio rerio


Alignment Length:333 Identity:163/333 - (48%)
Similarity:207/333 - (62%) Gaps:76/333 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GMFFSHRDLHTILTLREQGKPFYLYTGRGPSSGSLHVGHLVPFIMTKWLQETFDVPLVIQLTDDE 160
            |:.|  ||:|.||...||.|||||||||||||.::|||||:|||.|||||:.|||||||||||||
Zfish     4 GLLF--RDMHQILDAFEQQKPFYLYTGRGPSSQAIHVGHLIPFIFTKWLQDVFDVPLVIQLTDDE 66

  Fly   161 KTLWKDLKVEDAIKLGRENAKDIVAIGFDVNKTFIFNNLEFVGKCPAMYQNIIRIQKCVTFNQVK 225
            |.|||||.:|:..:...|||:||:|.||||||||||::||::|..||.|:|::::||.|||||||
Zfish    67 KYLWKDLTLEECRRFTVENARDIIACGFDVNKTFIFSDLEYMGASPAFYRNVVKVQKHVTFNQVK 131

  Fly   226 GIFGFGDSDIIGKIGFPAAQAAPAISSTFPFIFGNRKVHCLIPCAIDQDPYFRMTRDVAPRLGFP 290
            |||||.|||.||||.|||.||||:.|::||.|                                 
Zfish   132 GIFGFTDSDCIGKISFPAIQAAPSFSNSFPQI--------------------------------- 163

  Fly   291 KCALIHSTFFPALQGAKTKMSASDQNSAVYLTDTPKQIKNKINKYAFSGGRVSVEEHRKLGGVPE 355
                                                     :||:|||||:.::||||||||.|:
Zfish   164 -----------------------------------------VNKHAFSGGKDTIEEHRKLGGDPD 187

  Fly   356 VDVSYQLLKFFLEDDAKLEEVRVAYSKGEMLTGEIKKLAVETLTPIVEQHQAARKLITDEVLDKY 420
            ||||:..|.||||||.:||::|..||.|.|||||:||..::||.||:.:||..||.:||:::.::
Zfish   188 VDVSFMYLTFFLEDDEQLEKIRQDYSSGAMLTGELKKSLIDTLQPIIAEHQEKRKHVTDDIVQQF 252

  Fly   421 FELRPLKF 428
            ...|.|.|
Zfish   253 MTPRKLHF 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrpRSNP_524826.1 PLN02486 45..426 CDD:178104 161/329 (49%)
trpS 115..422 CDD:272975 151/306 (49%)
warsXP_017207181.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D300066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.