DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and MESK4

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster


Alignment Length:204 Identity:43/204 - (21%)
Similarity:72/204 - (35%) Gaps:69/204 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LAFSSGKTRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVETEFM---KNDIRHI 140
            ::.||..:.:|||....||:..|....:||     |:...|| ..:....:|:|:   .||.|::
  Fly    66 ISISSCPSEDVSFSESILEDNGRISLAYEN-----LKTIPRR-LADKFAAQTKFLDLSHNDFRNL 124

  Fly   141 LFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKP 205
            .|            .||...:|.:.:..:   |.|.|..:.|      :|....:...||.:...
  Fly   125 RF------------LSFFEDLDTLILDRN---VNLDINTFPY------LPSLRILWINNCDIANI 168

  Fly   206 SE----IAANC-----------------------AKFIADVIP--KYLD------NDCYPVVCG- 234
            ::    |..:|                       .::|..|:|  ||||      |..|..:.. 
  Fly   169 TDWIHRIERHCPALDQLSCMGNPGIRTVFGGQGPREYILQVLPQLKYLDGLPTSRNAAYATLSSS 233

  Fly   235 ---GPSETA 240
               ||..|:
  Fly   234 QGQGPDSTS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 43/204 (21%)
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 8/32 (25%)
leucine-rich repeat 133..154 CDD:275378 5/29 (17%)
leucine-rich repeat 155..181 CDD:275378 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.