DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and ALDH8A1

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_072090.1 Gene:ALDH8A1 / 64577 HGNCID:15471 Length:487 Species:Homo sapiens


Alignment Length:454 Identity:113/454 - (24%)
Similarity:188/454 - (41%) Gaps:80/454 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EEHENEIISALEA----DLRRPKQESLIVETEFMKNDIRHILFQ-LDEWVQSEKP---------- 153
            :|.|..:.:|.||    ..|.|::.|.::      |.:..:|.| |:|:.|:|..          
Human    45 DEIEAAVKAAREAFPSWSSRSPQERSRVL------NQVADLLEQSLEEFAQAESKDQGKTLALAR 103

  Fly   154 ----PKSFVN----------------MMDDV----QIYNDPFGVVLVIGAWNYPLQLLLVPVASA 194
                |:|..|                .||.:    .....|.||..:|..||.||.||...:|.|
Human   104 TMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPA 168

  Fly   195 IAAGNCVVIKPSEIAANCAKFIADVIPKYLDNDCYP-----VVCGGPSETAELL--NQRFDYIFY 252
            :||||.|:.||||:.:..|..:.    |.||....|     :|.|......|.|  :.....|.:
Human   169 MAAGNTVIAKPSELTSVTAWMLC----KLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISF 229

  Fly   253 TGSTRVGKIIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKLINCGQTCIAPDYIL 317
            |||....:.|...:..:....:||||||:|..|.:..::...:...:.....|.|:.|:....|.
Human   230 TGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIF 294

  Fly   318 CSKEVQEKFIVEAKDVLKEWYGENIQSSP--DLSRVINANNFQRLLGLMK-----SGRVAVGGNY 375
            ..|.:..:|:....:..::| ...|.|.|  .:..:|:..:.:::...:|     ..::..|...
Human   295 VQKSIYSEFLKRFVEATRKW-KVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGAQIWCGEGV 358

  Fly   376 D--------ASERFIEPTILVDVKETDPIMEEEIFGPILPIFNVESAYDAIKFINAREKPLVIYV 432
            |        .:..|:.||::.|:|:....|.||||||:..:...:|..:.|:..|..:..|...|
Human   359 DKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATV 423

  Fly   433 FSNSNKLVKEFRRSTTSGGFSSNETIMHCGVD---VLPFGGVGMSGMGRYHGKYGFETFTHKKS 493
            :|::...|....:...||...:|     |.:.   .|||||:..||:||...|..::.||..|:
Human   424 WSSNVGRVHRVAKKLQSGLVWTN-----CWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKT 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 113/454 (25%)
ALDH8A1NP_072090.1 ALDH_F8_HMSADH 27..485 CDD:143412 113/454 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.