DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and CG12516

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster


Alignment Length:183 Identity:36/183 - (19%)
Similarity:63/183 - (34%) Gaps:54/183 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TRNVSFRRKQLENLL-------RCYEEHENEIISALEADLRRPKQESL-------IVETEFMKND 136
            |.:::|..|..||.:       ....|.|.|:|...|    .||:|.:       .:...|...|
  Fly    36 TEDINFEEKSNENEVEDNTEKSEAVSESEKEVIEVSE----EPKEEEVKYAWNAPCMMVIFEDGD 96

  Fly   137 IRHILFQLDEWVQSEKPPKSFVNMMDDVQIYNDPF-----GVVLVIGAWNYPLQ----LLLVPVA 192
            :...|..|.|.:|                   |||     .|:||..|....::    :|:.|:.
  Fly    97 VNCALHHLVESLQ-------------------DPFALDAVAVILVQEALAEEIENRVKILMKPLD 142

  Fly   193 SAIAAGNCV--------VIKPSEIAANCAKFIADVIPKYLDNDCYPVVCGGPS 237
            :.:|...|.        .::|..|.....:.:.|..|..:.:..:..:..||:
  Fly   143 ARVANHPCYKRTLMKIDELRPKTIIGPSDRVLPDATPIMVRDIPHKFLGDGPT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 36/183 (20%)
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 23/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.