DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and Aldh16a1

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001028878.1 Gene:Aldh16a1 / 361571 RGDID:1566295 Length:802 Species:Rattus norvegicus


Alignment Length:297 Identity:66/297 - (22%)
Similarity:110/297 - (37%) Gaps:46/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EPEPETESPIGIFT----SQPESQQQQPEQLQSESESDRMA-----NFDDTLQRARLAFSSGKTR 87
            |..|....|.|:|.    ..|.:|..:|.:..|...|..:|     :....::.|..|......:
  Rat   519 ETGPSPAPPYGLFVRGRFQSPGTQSSRPIKDSSGKVSSYVAEGGAKDIRGAVEAAHQAAPGWGAQ 583

  Fly    88 NVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVETEFMKNDIRHILFQLDEW---VQ 149
            :...|...|..|....|..:    ..|.|.|.|......:.||| ::..:|    :|..|   ||
  Rat   584 SPRARASLLWALAAALERRK----QVLAAQLERHGAAPTVAETE-VELSVR----RLQTWATRVQ 639

  Fly   150 SEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKPSE----IAA 210
            .:........:...|....:|.||:.|:....:|:...:..:|.|:|.||.||:.||.    :|.
  Rat   640 DQGQTLQVTGLRGPVLRLREPLGVLAVVCPDEWPMLAFVSLLAPALAHGNAVVLVPSGSCPLLAL 704

  Fly   211 NCAKFIADVIPKYLDNDCYPVVCGGPSETAE--LLNQRFDYIFYTGSTRVGKIIHAAANKYLTPT 273
            ...:.||.:.|..|.|    ||.|.......  .|:|....::|.||.:..:.:..|:...|.|.
  Rat   705 EACQDIAALFPAGLVN----VVTGDRDHLTRCLALHQDVQAMWYFGSAQGSQFVEWASAGNLKPV 765

  Fly   274 ----------TLELGGKSPCYIDKSVDMRTAVKRILW 300
                      .:|:.|.     ::.:.:..|..:.||
  Rat   766 WVNRDFPRAWDVEVQGS-----EQELSLHAARTKALW 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 55/248 (22%)
Aldh16a1NP_001028878.1 ALDH-SF 19..491 CDD:416387
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..554 9/34 (26%)
ALDH-SF 550..>765 CDD:416387 52/227 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.