DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and CG11634

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001286129.1 Gene:CG11634 / 35434 FlyBaseID:FBgn0032968 Length:298 Species:Drosophila melanogaster


Alignment Length:387 Identity:80/387 - (20%)
Similarity:127/387 - (32%) Gaps:139/387 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PESQQQQPEQLQSESESDRMANFDDTLQRARLAFSSGKTRNVSFRRKQLENLLRCYEEHENEIIS 112
            ||.:......::..||:||....|.|        ||             ..|:..:|  |.:|.|
  Fly    40 PEGRSPDHSVIEMTSEADRHIGHDVT--------SS-------------PQLMIIFE--EGDINS 81

  Fly   113 ALEADLRRPKQESLIVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVI 177
            ||...:     ||  |...|..|.:..:|  ::|.::.|                     :|..|
  Fly    82 ALHFII-----ES--VHNPFASNAVAMVL--VEEKIRGE---------------------IVERI 116

  Fly   178 GAWNYPLQLLLVPVASAIAA------GNCVVIKP--SEIAANCAK--FIADVIPKYLDNDCYPVV 232
            .:..:||...:....|.:||      .|..:|:.  ||:|...|.  |:.|.....|.:  ||. 
  Fly   117 LSKLHPLSKFVAEHPSYLAALEKCHTSNFNIIRACISEVAPPMASPIFVCDCTHDKLGS--YPT- 178

  Fly   233 CGGPSETAELLNQRFDYIFYTGSTRVGKIIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKR 297
             |..:......||....|....|.....:  :..|:.||          .||     |:..|:..
  Fly   179 -GVVTFHTFRNNQEAIAISQCESLAFASV--SIWNETLT----------GCY-----DLVAALSS 225

  Fly   298 ILWGKLINCGQTCIAPDYILCSKEVQEKFIVEAKDVLKEWYGENIQSSPDLSRVINANNFQRLLG 362
            ..:  .:||....::|  ||...:.|:.::|                      |.|..:|:.|  
  Fly   226 SYF--FLNCANVDLSP--ILKPHKAQKNYVV----------------------VENGFHFETL-- 262

  Fly   363 LMKSGRVAVGGNYDASERFIEPTILVDVKETDPIMEEEIFGPILP-IFNVESAYDAIKFINA 423
                 |:     ||..:..:.|                |.|.||| |.:.:..:.||.|:.|
  Fly   263 -----RI-----YDNFKAIVFP----------------IGGQILPDIEDHKEEHAAIFFLEA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 73/363 (20%)
CG11634NP_001286129.1 DUF1487 64..279 CDD:254173 65/342 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.