DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and CG8665

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_610107.1 Gene:CG8665 / 35407 FlyBaseID:FBgn0032945 Length:913 Species:Drosophila melanogaster


Alignment Length:471 Identity:128/471 - (27%)
Similarity:194/471 - (41%) Gaps:80/471 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DDTLQRARLAFSSGKTRNVSFR-RKQLE-NLLRCYEEHENEIISALEADLRRPKQESLIVETEFM 133
            |..::.|..|| .|..|.::.| |.||. ||....|.::.|:.:....|       |..|.|..:
  Fly   473 DKAVRAAHSAF-YGSWRQITPRQRGQLMLNLADLMERNKEELATIESVD-------SGAVYTLAL 529

  Fly   134 KNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQ-----------------IYNDPFGVVLVIGAWN 181
            |.   |:...::.|       :.|....|.:|                 ...:|.||..:|..||
  Fly   530 KT---HVGMSIEAW-------RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWN 584

  Fly   182 YPLQLLLVPVASAIAAGNCVVIKPSEIAANCAKFIADV-----IPKYLDNDCYPVVCGGPSETAE 241
            |||.:|...:|:.|||||..:|||::.....|...|::     .|..:.|    |:.|..|:..:
  Fly   585 YPLMMLSWKMAACIAAGNTCLIKPAQTCPLTALKFAELTVRAGFPPGVIN----VLPGKGSDAGQ 645

  Fly   242 LL--NQRFDYIFYTGSTRVGK-IIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKL 303
            .:  ::....:.:||||.:|| |:.:.|:..|...:||||||||..|....||..|||..:....
  Fly   646 AVADHELVRKLGFTGSTPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDMDKAVKHGMSSVF 710

  Fly   304 INCGQTCIAPDYILCSKEVQEKFIVEAKDVLKEWYGENIQSSPDLSRVINANN----FQRLL--- 361
            .|.|:.|||...:.....:.::||   :.|||:.....|....|.|......|    |.:||   
  Fly   711 FNKGENCIAAGRLFVEDRIHDEFI---RRVLKDLRTMTIGDPLDRSTAHGPQNHKAHFDKLLEFC 772

  Fly   362 --GLMKSGRVAVGG-------NYDASERFIEPTILVDVKETDPIMEEEIFGPILPI--FNVESAY 415
              |:.:..::..||       .|     |..||:..:|.:...|.:||.||||:.|  ||.....
  Fly   773 RRGVDEGAKLVYGGCRVPNLKGY-----FFTPTVFTNVTDDMFIAQEESFGPIMIISKFNGSDID 832

  Fly   416 DAIKFINAREKPLVIYVFSNSNKLVKEFRRSTTSGGFSSNETIMHCGVDV-LPFGGVGMSGMGRY 479
            ..::..|..|..|...||:........|.....:|....|   ::...|| .||||...||.|:.
  Fly   833 SLMQRANRTEYGLASGVFTKDIGKALNFADRIEAGTVFVN---VYNKTDVAAPFGGFKQSGYGKD 894

  Fly   480 HGKYGFETFTHKKSCL 495
            .|:.....:. |..|:
  Fly   895 LGQEALNEYL-KTKCV 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 127/470 (27%)
CG8665NP_610107.1 Fmt 4..315 CDD:223301
FMT_core 5..207 CDD:294280
FDH_Hydrolase_C 212..316 CDD:187731
PP-binding 338..403 CDD:278949
PLN02466 396..909 CDD:215259 127/469 (27%)
ALDH_F1L_FTFDH 428..913 CDD:143458 128/471 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.