DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and P5CDh2

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster


Alignment Length:357 Identity:88/357 - (24%)
Similarity:146/357 - (40%) Gaps:70/357 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 GVVLVIGAWNYPLQLLLVPVASAIA-----AGNCVVIKPSEIAANCAKFIADVIPKYLDNDCYP- 230
            |.|..|..:|:      ..:|:.:|     .||.|:.|||:.|.....|:.    |.|.....| 
  Fly   221 GFVAAISPFNF------TGIAANLAYTPALMGNSVIWKPSDSAILSNYFVF----KALREAGVPD 275

  Fly   231 -VVCGGPSET---AELLNQ--RFDYIFYTGSTRVGKIIHAAA----NKYLTPTTL--ELGGKSPC 283
             ||...|:|.   |.::.|  :...|.:||::.|.|::....    |.|.....|  |.|||:..
  Fly   276 GVVNFVPAEETTFASVVTQHPKLAGINFTGTSTVLKVLWQLVAQNINFYQNYPRLVGEGGGKNFH 340

  Fly   284 YIDKSVDMRTAVKRILWGKLINCGQTCIAPDYI-----LCSKEVQEKFI-VEAKDVLKE--WYGE 340
            ::..|.:..|||...:.......||.|.:...:     |....::|..: :.|..|:::  .|.:
  Fly   341 FVHSSAEPETAVACTIRAAFEYAGQKCSSCSMLYVPESLWQNHIREPLLEITASLVVRQDATYCD 405

  Fly   341 NIQSSPDLSRVINANNFQRLLGLMK------SGRVAVGGNYDASE-RFIEPTILVDVKETDPIM- 397
            :.     .|.|||...:.|:...::      |.::.|||:.|... .:::||::: ||:.|.|: 
  Fly   406 SF-----CSAVINRRAYDRIYMWLRYIDQSPSCQILVGGSCDKRRGYYVDPTVVL-VKDLDNIIC 464

  Fly   398 EEEIFGPILPIFNVESAYDAIKFINAREKPLVI------YVFSNSNKLVKE----FRRSTTSGGF 452
            .||:..|||.::    .|...|.....||...|      .||:.....::|    ||  ...|..
  Fly   465 REELLAPILGVY----VYPDHKLKETMEKVAQINHGLTGSVFAQDQNFIEEAYDAFR--VNVGNL 523

  Fly   453 SSNETIMHCGVDVLPFGGVGMSG----MGRYH 480
            :.|:......|...|||...|:|    :|..|
  Fly   524 NVNDKSTGLMVGQQPFGAGHMTGTSDKLGTPH 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 88/357 (25%)
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 88/357 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.