DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and CG15717

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster


Alignment Length:210 Identity:46/210 - (21%)
Similarity:74/210 - (35%) Gaps:61/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VINIEPEPETESPIGIFTSQPESQQQQPEQLQSESESDRMANFDDTLQRARLAFSSGKTRNVSFR 92
            |..::|..: |:.:.:..|.|  |.:.|:.:....:.|..:.....||..:..|:.|....:   
  Fly    18 VNQLQPTAQ-ETKLALIPSAP--QWRSPQLMVVFEDGDLHSARHQLLQSLQNPFAEGSVATL--- 76

  Fly    93 RKQLENLLRCYEEHENEIISALEADLR--------RPKQESLIVETEFMKNDIRHILFQLDEWVQ 149
                  ||:  |...::.:..:..|||        .|...|.:.:.|.:|          .:.||
  Fly    77 ------LLQ--ESIADQFVGLVAQDLRPLSQEVSKHPSYTSTLAKIEELK----------AKTVQ 123

  Fly   150 SE--KPPKSFVNMMDDVQIY--NDPFGVVLV----------------------IGAWNYPLQLL- 187
            .|  |..:|.|.:.|.|..|  |...|||.|                      :..||..|... 
  Fly   124 GESLKAGESPVLVYDCVHSYLGNGATGVVTVHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAY 188

  Fly   188 -LVP-VASAIAAGNC 200
             |:| :.|.|.|.||
  Fly   189 ELIPRLPSDIVAINC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 38/166 (23%)
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 41/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.