Sequence 1: | NP_724562.2 | Gene: | Aldh-III / 45398 | FlyBaseID: | FBgn0010548 | Length: | 564 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_732186.1 | Gene: | CG31274 / 318655 | FlyBaseID: | FBgn0051274 | Length: | 280 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 43/204 - (21%) |
---|---|---|---|
Similarity: | 72/204 - (35%) | Gaps: | 69/204 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 LAFSSGKTRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVETEFM---KNDIRHI 140
Fly 141 LFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKP 205
Fly 206 SE----IAANC-----------------------AKFIADVIP--KYLD------NDCYPVVCG- 234
Fly 235 ---GPSETA 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Aldh-III | NP_724562.2 | ALDH_F3AB | 72..515 | CDD:143450 | 43/204 (21%) |
CG31274 | NP_732186.1 | leucine-rich repeat | 111..132 | CDD:275378 | 8/32 (25%) |
leucine-rich repeat | 133..154 | CDD:275378 | 5/29 (17%) | ||
leucine-rich repeat | 155..181 | CDD:275378 | 4/25 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |