DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and CG31076

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster


Alignment Length:41 Identity:12/41 - (29%)
Similarity:19/41 - (46%) Gaps:6/41 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 VIPKYLDNDCYPVVCGGP--SETAEL----LNQRFDYIFYT 253
            :|.|:..|..|..:.|.|  .:..||    ...|:||.:|:
  Fly    99 LIRKFFPNLQYLSLHGNPICPDGLELQPFSTYLRYDYEYYS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 12/41 (29%)
CG31076NP_733184.2 LRR_8 11..65 CDD:290566
leucine-rich repeat 11..32 CDD:275378
leucine-rich repeat 33..54 CDD:275378
leucine-rich repeat 55..79 CDD:275378
leucine-rich repeat 80..106 CDD:275378 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.