DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and ALDH2

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_000681.2 Gene:ALDH2 / 217 HGNCID:404 Length:517 Species:Homo sapiens


Alignment Length:461 Identity:131/461 - (28%)
Similarity:219/461 - (47%) Gaps:51/461 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SESDRMANFDDTLQRARLAFSSGK--TRNVSFRRKQLENLLRCYEEHENEIISALEA-DLRRPKQ 123
            :|.|: .:.|..::.||.||..|.  .|..:..|.:|.|.|....|.:...::|||. |..:|..
Human    69 AEGDK-EDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYV 132

  Fly   124 ESLIVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQIY--NDPFGVVLVIGAWNYPLQL 186
            .|.:|:.:.:...:|:.....|::.....|      :..|...|  ::|.||...|..||:||.:
Human   133 ISYLVDLDMVLKCLRYYAGWADKYHGKTIP------IDGDFFSYTRHEPVGVCGQIIPWNFPLLM 191

  Fly   187 LLVPVASAIAAGNCVVIKPSEIAANCAKFIADVI-----PKYLDNDCYPVVCG-GPSETAELL-N 244
            ....:..|:|.||.||:|.:|.....|.::|::|     |..:.|    :|.| ||:..|.:. :
Human   192 QAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN----IVPGFGPTAGAAIASH 252

  Fly   245 QRFDYIFYTGSTRVGKIIH-AAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKLINCGQ 308
            :..|.:.:||||.:|::|. ||.:..|...|||||||||..|....||..||::..:....|.||
Human   253 EDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQ 317

  Fly   309 TCIAPDYILCSKEVQEKF----IVEAKDVLKEWYGENIQSSPDLSRVINANNFQRLLGLMKSG-- 367
            .|.|.......:::.::|    :..||..:   .|....|..:....::...|:::||.:.:|  
Human   318 CCCAGSRTFVQEDIYDEFVERSVARAKSRV---VGNPFDSKTEQGPQVDETQFKKILGYINTGKQ 379

  Fly   368 ---RVAVGGNYDASER--FIEPTILVDVKETDPIMEEEIFGPILPIFNVESAYDAIKFINAREKP 427
               ::..||.. |::|  ||:||:..||::...|.:||||||::.|...::..:.:...|.....
Human   380 EGAKLLCGGGI-AADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYG 443

  Fly   428 LVIYVFSNSNKLVKEFRRST-TSGGFSSNETIMHCGVDVL----PFGGVGMSGMGRYHGKYGFET 487
            |...||:      |:..::. .|....:....::| .||.    ||||..|||.||..|:||.:.
Human   444 LAAAVFT------KDLDKANYLSQALQAGTVWVNC-YDVFGAQSPFGGYKMSGSGRELGEYGLQA 501

  Fly   488 FTHKKS 493
            :|..|:
Human   502 YTEVKT 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 128/451 (28%)
ALDH2NP_000681.2 ALDH_F1AB_F2_RALDH1 31..511 CDD:143459 131/461 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.