DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and ALDH1L1

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001257293.1 Gene:ALDH1L1 / 10840 HGNCID:3978 Length:912 Species:Homo sapiens


Alignment Length:476 Identity:133/476 - (27%)
Similarity:206/476 - (43%) Gaps:83/476 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RMANFDDTLQRARLAFSSGKTRNVSFRRK-----QLENLLRCYEEHENEI--ISALEADLRRPKQ 123
            ::.:.|..:..|:.||.:|:...:|.|.:     :|.:|:   |:|:.|:  |.||:|.      
Human   467 QVTDVDKAVAAAKDAFENGRWGKISARDRGRLMYRLADLM---EQHQEELATIEALDAG------ 522

  Fly   124 ESLIVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQ-----------------IYNDPF 171
               .|.|..:|.   |:...:..:       :.|....|.:|                 ...:|.
Human   523 ---AVYTLALKT---HVGMSIQTF-------RYFAGWCDKIQGSTIPINQARPNRNLTLTRKEPV 574

  Fly   172 GVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKPSEIAANCAKFIADV-----IPKYLDNDCYPV 231
            ||..:|..|||||.:|....|:.:||||.|||||:::....|...|::     |||.:.|    |
Human   575 GVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVN----V 635

  Fly   232 VCGGPSETAELLNQRFDY--IFYTGSTRVGK-IIHAAANKYLTPTTLELGGKSPCYIDKSVDMRT 293
            :.|..|...:.|:...|.  |.:||||.||| |:.:.|...:...:||||||||..|....|:..
Human   636 LPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNK 700

  Fly   294 AVKRILWGKLINCGQTCIAPDYILCSKEVQEKFIVE-AKDVLKEWYGENIQSSPDLSRVINANNF 357
            ||:..:.....|.|:.|||...:.....:.::|:.. .::|.|...|..:....|..   ..|:.
Human   701 AVQMGMSSVFFNKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHG---PQNHH 762

  Fly   358 QRLLGLM-------KSGRVAV-GGN-YDASERFIEPTILVDVKETDPIMEEEIFGPILPIFN-VE 412
            ..|:.||       |.|...| ||| ......|.|||:..||::...|.:||.|||::.|.. .:
Human   763 AHLVKLMEYCQHGVKEGATLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFAD 827

  Fly   413 SAYDAI-KFINAREKPLVIYVFS---NSNKLVKEFRRSTTSGGFSSNETIMHCGVDV-LPFGGVG 472
            ...||: ...||.|..|...||:   |....|.:..::.|....:.|:|      || .||||..
Human   828 GDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKT------DVAAPFGGFK 886

  Fly   473 MSGMGRYHGKYGFETFTHKKS 493
            .||.|:..|:.....:...|:
Human   887 QSGFGKDLGEAALNEYLRVKT 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 132/470 (28%)
ALDH1L1NP_001257293.1 Fmt 10..319 CDD:223301
FMT_core_FDH_N 11..213 CDD:187716
FDH_Hydrolase_C 216..316 CDD:187731
PP-binding 335..401 CDD:278949
ALDH_F1L_FTFDH 427..912 CDD:143458 133/476 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.