DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh-III and aldh1l2

DIOPT Version :9

Sequence 1:NP_724562.2 Gene:Aldh-III / 45398 FlyBaseID:FBgn0010548 Length:564 Species:Drosophila melanogaster
Sequence 2:XP_002661418.2 Gene:aldh1l2 / 100333269 ZFINID:ZDB-GENE-100426-6 Length:923 Species:Danio rerio


Alignment Length:467 Identity:121/467 - (25%)
Similarity:199/467 - (42%) Gaps:67/467 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 MANFDDTLQRARLAFSSGK--TRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVE 129
            :|:.|..:..|:.||.:|.  ..|...|.:.|..|....|||:.|:.:....|       |..|.
Zfish   479 VADVDKAVSAAKEAFDNGPWGKMNPRDRGQLLYRLADLMEEHQEELATIETID-------SGAVY 536

  Fly   130 TEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQ-----------------IYNDPFGVVLVI 177
            |..:|.   |:...:..:       :.|....|.:|                 ...:|.||..::
Zfish   537 TLALKT---HVGMSIQTF-------RYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIV 591

  Fly   178 GAWNYPLQLLLVPVASAIAAGNCVVIKPSEIAANCAKFIADV-----IPKYLDNDCYPVVCGGPS 237
            ..|||||.:|....|:.:||||.:|:||:::....|...|::     |||.:.|    :|.|...
Zfish   592 IPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELTIKAGIPKGVIN----IVPGSGG 652

  Fly   238 ETAELLNQRFDY--IFYTGSTRVGK-IIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRIL 299
            ...:.:::..|.  :.:||||.:|| |:.:.|...|...:||||||||..|....||..||:..:
Zfish   653 LVGQRMSEHPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCDMDKAVRMGM 717

  Fly   300 WGKLINCGQTCIAPDYILCSKEVQEKFIVEAKDVLKEW-YGENIQSSPDLSRVINANNFQRL--- 360
            .....|.|:.|||...:...:.:.:::|....:.:|:. .|:.:..|.|.....:..:..:|   
Zfish   718 SSVYFNKGENCIAAGRLFVEESIHDEYIRRVVEEIKKMKIGDPLDRSTDHGPQNHKAHMDKLVEY 782

  Fly   361 --LGLMKSGRVAVGG-NYDASERFIEPTILVDVKETDPIMEEEIFGPILPI--FNVESAYDAIKF 420
              :|:.:...:..|| ..|....|:|||:..||::...|.:||.|||::.:  |........:..
Zfish   783 CEIGVKEGATLVYGGRQVDRPGFFMEPTVFTDVEDHMFIAKEESFGPVMVVSKFKDGDVDGVLSR 847

  Fly   421 INAREKPLVIYVFSNS-NKLVKEFRRSTTSGGF--SSNETIMHCGVDV-LPFGGVGMSGMGRYHG 481
            .|..|..|...||:.. ||.:....|......|  :.|:|      || .||||...||.|:..|
Zfish   848 ANDTEFGLASGVFTRDINKAMYVSERLEAGTVFINTYNKT------DVAAPFGGFKQSGFGKDLG 906

  Fly   482 KYGFETFTHKKS 493
            :.....:...|:
Zfish   907 EDALHEYLRTKA 918

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aldh-IIINP_724562.2 ALDH_F3AB 72..515 CDD:143450 119/462 (26%)
aldh1l2XP_002661418.2 Fmt 22..323 CDD:223301
FMT_core_FDH_N 23..225 CDD:187716
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..412 CDD:278949
ALDH_F1L_FTFDH 438..923 CDD:143458 121/467 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.